PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014883
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 266aa    MW: 29686.9 Da    PI: 5.4573
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014883genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.62.1e-151148340
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                 i n+s r+ tf kR+ g++KK  ELS+LCd++++ i+ 
  Lus10014883 11 IANESARKATFKKRKWGLMKKVRELSTLCDIQACAIVN 48
                 89********************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.175147IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-17162IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-20187IPR002100Transcription factor, MADS-box
CDDcd002664.60E-22288No hitNo description
PRINTSPR004041.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003196.8E-161150IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MARKKLKQMY IANESARKAT FKKRKWGLMK KVRELSTLCD IQACAIVNNP FDETQPPETW  60
PPTVAGVHQV LTRFKEMPMV DQVRDMVNQK KFLDHRIKKA ANEGKKYDDE NSQKEVDLMV  120
IHCLAGRMDL QGLPMSDFEL ISRTIERKIK EVDECLAKLS RIDGGGNVLV APQVAGDHGG  180
GGGNQEEYVD GMKRQQLLTE AMMNDPAAAT VGVDDEWMTM SMMMDQRAGT SGMDVGESSS  240
NVETLSTSNT IPTWNSSDPF FGWDF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKLKQMYIANESARKATFKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPOPTR_0005s00420.13e-43(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-31AGAMOUS-like 80